PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa006956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 340aa    MW: 36229.4 Da    PI: 7.8507
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-49494PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-12104148347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar    +Rt+ q+ s+ qk+
        Lsa006956 104 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVITRTPTQVASHAQKF 148
                      8*****************************89***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.63397153IPR017930Myb domain
SuperFamilySSF466891.08E-1699154IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-19100152IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.8E-11101144IPR009057Homeodomain-like
SMARTSM007171.4E-10101151IPR001005SANT/Myb domain
PfamPF002491.6E-10104147IPR001005SANT/Myb domain
CDDcd001672.54E-9104149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPN RGLKLFGVRI TDGSIRKSAS MGNLSHCNGS GSGAFFNGFS  60
GGGGGTDLDS PGDTPDHNAA GDGYGSEDFV AGSSSSRERK KGVPWTEEEH RMFLLGLQKL  120
GKGDWRGIAR NYVITRTPTQ VASHAQKFFI RQSNISRRKR RSSLFDIVAD DFPSQPETQS  180
VKNPLTIPTL EEEECESMDS ANSTTADPQI DPTPKTATVS VNLEGGSGSQ CLIPMMFPAY  240
VSPIIPVAIP YWPGPSCQDQ DSMAKTEAHE VLKPTAVHSK SPINVDDLLG MSKLTLGDGG  300
GAPTSLKVGG LSRQSAFHAS NPGARPSSKM DSNHSPIHAV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477144.11e-140PREDICTED: transcription factor MYB1R1
TrEMBLA0A118JUZ40.0A0A118JUZ4_CYNCS; Homeodomain-like protein
STRINGVIT_00s0299g00060.t011e-133(Vitis vinifera)
STRINGSolyc08g078340.2.11e-132(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-124MYB_related family protein